DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG32374

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:228 Identity:69/228 - (30%)
Similarity:104/228 - (45%) Gaps:15/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIKGGEEAEIGFAPYQVSLQPIVGSHN----CGGAILNENWIITAGHC-VENFIPALVNVITGTN 95
            ||..|::.:...||||.:|.     :|    ||..|||..||:||.|| :.|  |....|..|:.
  Fly    73 RIVNGKKIKCSRAPYQCALH-----YNNYFICGCVILNRRWILTAQHCKIGN--PGRYTVRAGST 130

  Fly    96 KWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALP-TRPVQLGEEIVLTG 159
            :....|.:.:..:...|..|.:..|.||:.::||...:......|.:.|| ||..:..:..:.:|
  Fly   131 QQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKCYLASG 195

  Fly   160 WGSDVAYGSSMED-LHKLTVGLVPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSN 223
            ||...|...:::. |..:.|..|...:|.:.:..|.......:....|:....|.||||||||.|
  Fly   196 WGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGGPLVHN 260

  Fly   224 GQLVGVVNWGRPC-GVGLPDVQANVYYYLDWIR 255
            |.|.|:.::|..| ....|.|..||..|..||:
  Fly   261 GVLYGITSFGIGCASAKYPGVYVNVLQYTRWIK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 67/225 (30%)
Tryp_SPc 39..257 CDD:238113 67/225 (30%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 67/225 (30%)
Tryp_SPc 74..295 CDD:238113 68/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.