DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and sphinx2

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:286 Identity:69/286 - (24%)
Similarity:109/286 - (38%) Gaps:71/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLRLSLLILLAVKPPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQV--------SLQPI 57
            |||:...|::.|..   :.||..::        |.||.||..|:    ||.:        :..|:
  Fly     1 MKLVVALLVLSLTF---SVCEKNKL--------SPRITGGYRAK----PYTIIYLVGIVYAKSPL 50

  Fly    58 VGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNK--WAEPGAIYYTAEIHKHCMYDQPYM 120
            .......|.|::..||:|.   .|..|...:....|:.:  |.     |....|::    :..|.
  Fly    51 SSLKFGAGTIISNQWILTV---KEVLIFKYIEAHFGSKRAFWG-----YDILRIYR----ENFYF 103

  Fly   121 HND----IALVKLTENITFNELTQPIALPTRPVQ----LGEEIVLTGWGSDVAYGSSMEDLHKLT 177
            |.|    |||||.... .|:.....:.:|....:    :|...::.|||:|           |..
  Fly   104 HYDKTRIIALVKCPYQ-KFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTD-----------KRK 156

  Fly   178 VGLVPLDEC--YETFNRT------SSMGVGHICTFSREGEGACHGDSGGPLVS---NGQLVGVVN 231
            |.|.....|  .|..|.|      :.:....:||.....:|.|.||.||.:|:   |...:|:: 
  Fly   157 VRLPTWMRCVEVEVMNNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII- 220

  Fly   232 WGRP--CGVGLPDVQANVYYYLDWIR 255
            |..|  |.:|.|.|...|..::.||:
  Fly   221 WLMPTNCSIGYPSVHIRVSDHIKWIK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 59/248 (24%)
Tryp_SPc 39..257 CDD:238113 59/248 (24%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 59/248 (24%)
Tryp_SPc 26..248 CDD:304450 60/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.