DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:278 Identity:82/278 - (29%)
Similarity:112/278 - (40%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLRLSLL--ILLAVKPPNPCESKRIVGPFPAGQS---GRIKGGEEAEIGFAPYQVSL--QPIV 58
            ||:|.:.||  |..|.....|...|.:    |.|::   |||..|..|..|..||.|.|  ....
  Fly     1 MKVLAVLLLGVIASATAFEKPVFWKDV----PVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNG 61

  Fly    59 GSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQ------ 117
            |...|||:|:...|::||.||.:..               |...|||.|.......|..      
  Fly    62 GGTWCGGSIIGNTWVMTAKHCTDGM---------------ESVTIYYGALWRLQAQYTHWVGRSD 111

  Fly   118 --PYMHNDIALVKLTENITFNELTQPIALPTRPVQL----GEEIVLTGWGSDVAYGSSMEDLHKL 176
              .:...||:|:: |.::.|..|...:.||....:.    |...:::|||.....|...|.|:.:
  Fly   112 FIEHGSGDISLIR-TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCV 175

  Fly   177 TVGLVPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLV--SNGQLVGVVNWGRPCGV- 238
            .|.:.....|.   |...|.....||..:.|.:|.|.||||||||  ...:.||:|::|...|. 
  Fly   176 DVQIGENSVCE---NYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCL 237

  Fly   239 -GLPDVQANVYYYLDWIR 255
             ..|.....|..||||||
  Fly   238 SNGPKGMVRVTSYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 67/235 (29%)
Tryp_SPc 39..257 CDD:238113 68/235 (29%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 67/235 (29%)
Tryp_SPc 41..257 CDD:238113 68/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.