DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:251 Identity:74/251 - (29%)
Similarity:112/251 - (44%) Gaps:49/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GRIKGGEEAEIGFAPYQVSLQ--PIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKW 97
            |||..|:.|..|..||||.|.  ...||..|||:|::..|::||.||...               
  Fly    38 GRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSG--------------- 87

  Fly    98 AEPGAIYYTAEIH---------------KHCMYDQPYMHNDIALVKLTENITFNELTQPIALP-- 145
            |....|||.|.:.               :|..|:...:.|||:|:| |..:.|..|...:.||  
  Fly    88 ASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAFTALINKVELPAI 151

  Fly   146 --TRPVQLGEEIVLTGWGSDVAYGSSMEDLHKLTV-GLVPLDECYETFN---RTSSMGVGHICTF 204
              |.....|::.:.:|||......:|:.:..:..| .:|.:.:|..|:.   .|:::    ||..
  Fly   152 AGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNV----ICVA 212

  Fly   205 SREGEGACHGDSGGP--LVSNGQLVGVVNW--GRPCGVGLPDVQANVYYYLDWIRS 256
            :......|:||||||  |||:.:|:||.::  ...|..|.|.....|..|||||::
  Fly   213 TPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAGFTRVTSYLDWIKT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 71/246 (29%)
Tryp_SPc 39..257 CDD:238113 71/247 (29%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 71/246 (29%)
Tryp_SPc 40..269 CDD:238113 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.