DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:274 Identity:77/274 - (28%)
Similarity:131/274 - (47%) Gaps:25/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLRLSLLILLAVKPPNP-----CESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSLQ---PI 57
            ||.|.:..|.:.|...|.|     .....:||..    .|||.||..|.:|..||||.|.   ..
  Fly     1 MKFLIILALAVAASAFPEPELRHRSREMPVVGDI----GGRITGGSNAAVGQFPYQVGLSLKLSA 61

  Fly    58 VGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHN 122
            :.|..|||:::...|::||.||.:......|.:.......||......:::|..|..::...:.|
  Fly    62 LSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLRN 126

  Fly   123 DIALVKLTENITFNELTQPIALP----TRPVQLGEEIVLTGWG--SDVAYGSSMEDLHKLTVGLV 181
            ||:|:|:....:.:.:: .:.||    :....:|:..|.:|||  ||.:.|.: .:|..:.:.::
  Fly   127 DISLIKIPATSSSSRIS-AVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVA-TNLQYVDLTVI 189

  Fly   182 PLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLV--SNGQLVGVVNWGRP--CGVGLPD 242
            ...:|.:|:. ||.:....:|..:.:.:..|:||||||||  |:.:.:|:.::|..  |..|.|.
  Fly   190 TNTKCAQTYG-TSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAGCEKGYPA 253

  Fly   243 VQANVYYYLDWIRS 256
            ....|..|||||::
  Fly   254 AFTRVTSYLDWIKT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 65/230 (28%)
Tryp_SPc 39..257 CDD:238113 65/231 (28%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 65/230 (28%)
Tryp_SPc 38..268 CDD:238113 66/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.