DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and yip7

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:270 Identity:82/270 - (30%)
Similarity:128/270 - (47%) Gaps:28/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLRLSLLILLAVKPPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQV--SLQPIVGSHNC 63
            :.|...|..:|..:.|.:|.:  |:..|   ..:|||..|::|..|..||||  |.....||..|
  Fly     9 LALASASAGLLPNIAPVHPRD--RVSTP---SITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWC 68

  Fly    64 GGAILNENWIITAGHCVENFIPALVNVITGTNKWAEP--GAIYYTAEIHKHCMYDQPYMHNDIAL 126
            ||:|:...|::||.||.:.  .|.|.:..|......|  ..:..:::..:|..|....:.|||:|
  Fly    69 GGSIIGNEWVLTAAHCTDG--AASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDISL 131

  Fly   127 VKLTENITFNELTQPIALP----TRPVQLGEEIVLTGWG--SDVAYGSSMEDLHKLTVGLVPLDE 185
            :: |.:::|:.....|:||    :.....|:..|.:|||  ||.|...| .||..:.:.::...:
  Fly   132 IQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVS-RDLQYVDLTIISNSK 194

  Fly   186 CYETFNR---TSSMGVGHICTFSREGEGACHGDSGGPLVSNGQLVGVVNWGRP--CGVGLPDVQA 245
            |.|||..   ||.:    :|..:......|.|||||||..:|.|:|..::|..  |..|.|....
  Fly   195 CQETFGSLIVTSRV----LCVDTTNKASTCQGDSGGPLALDGVLIGATSFGSADGCESGAPAAFT 255

  Fly   246 NVYYYLDWIR 255
            .:.||.|||:
  Fly   256 RITYYRDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 72/232 (31%)
Tryp_SPc 39..257 CDD:238113 72/232 (31%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 72/232 (31%)
Tryp_SPc 40..267 CDD:238113 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.