DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG10477

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:294 Identity:85/294 - (28%)
Similarity:129/294 - (43%) Gaps:64/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLRLSLLILLAVK--------PPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQV--SLQ 55
            ||:..:.:|.:..|.        |.:|.:|..:     ....|||..|.:|.....||||  |.:
  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRDSSAV-----PSIDGRITNGNKAAANQFPYQVGLSFK 60

  Fly    56 PIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYY------TAEIHK--- 111
            ...||..|||:|:...|::||.||               .|.|....|||      :|::.|   
  Fly    61 SSAGSWWCGGSIIANTWVLTAAHC---------------TKGASSVTIYYGSTVRTSAKLKKKVS 110

  Fly   112 ------HCMYDQPYMHNDIALVKLTENITFNELTQPIALP----TRPVQLGEEIVLTGWG----S 162
                  |..|:...:.|||:|:| |.::||......||||    :.....|:..|.:|||    |
  Fly   111 SSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDS 174

  Fly   163 DVAYGSSME--DLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSNGQ 225
            .:|..::::  ....:|..:     |.:||. :|.:..|.||..|...:..|.|||||||..|.:
  Fly   175 SIAVATNLQYAQFQVITNAV-----CQKTFG-SSVVTSGVICVESINKKSTCQGDSGGPLALNNR 233

  Fly   226 LVGVVNW--GRPCGVGLPDVQANVYYYLDWIRSK 257
            |:||.::  .:.|....|.....|..|||||:::
  Fly   234 LIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKNQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 75/246 (30%)
Tryp_SPc 39..257 CDD:238113 75/246 (30%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 75/246 (30%)
Tryp_SPc 40..267 CDD:238113 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.