DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG15873

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:224 Identity:62/224 - (27%)
Similarity:99/224 - (44%) Gaps:31/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SHNCGGAILNENWIITAGHCVENFIPALVN-----VITG--TNKWAEPGAIYYTAEIHK------ 111
            :|.|.|.:::...::||.||:.:...|.:|     |:.|  |..     |:|..::...      
  Fly    66 NHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRL-----AVYDESDFRSVDRLVV 125

  Fly   112 HCMYDQPYMHNDIALVKLTENI-TFNELTQPIAL-PTRPVQLGEEIVLTGWGSDVAYGSSMEDLH 174
            |..|:: |..||:|:::|:|.: :.|....|:.: .|..|..|:..:..|||....:|....:|.
  Fly   126 HPEYER-YKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQIYQHGPYSNELV 189

  Fly   175 KLTVGLVPLDEC---YETFNRTSSMGVGHICTFSREGEGA-CHGDSGGPLVSNGQLVGVVNWGRP 235
            .|.|.|.|...|   |:||....     ::|| ...||.. |.||.||||:..|.|.|::.....
  Fly   190 YLDVILRPPSLCQKHYDTFTADH-----NVCT-EPVGESMNCAGDMGGPLLCKGALFGLIGGHMG 248

  Fly   236 CGVGLPDVQANVYYYLDWIRSKLSGNNKC 264
            |..|......:..||.|||...:...:.|
  Fly   249 CAGGKAMKFLSFLYYKDWILLTIQSLSDC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 59/212 (28%)
Tryp_SPc 39..257 CDD:238113 61/215 (28%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 54/195 (28%)
Tryp_SPc 59..250 CDD:238113 54/195 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.