DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG13430

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:241 Identity:83/241 - (34%)
Similarity:128/241 - (53%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QSGRIKGGEEAEIGFAPYQVSLQPIVGS-HNCGGAILNENWIITAGHCV-ENFIPALVNVITGTN 95
            |.|||.||.|..|.|.|:|||||  :|: |.|||.|::.|.|:||.||| |...|....:..|::
  Fly    28 QDGRIVGGWETHITFFPHQVSLQ--LGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSS 90

  Fly    96 KWAEPGAIYYTAEIHKHCMYDQP-YMHNDIALVKLTENITFNELTQPIALPTRP--VQLGEEIVL 157
            .|.:.|:.....:|..|..:..| .|:||||:|:|.:.:.:::..:||:|.|..  :....::.:
  Fly    91 DWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFV 155

  Fly   158 TGWGSDVAYGSSMEDLHKLTVGLVPL---DECYETFNRTSSMGVGHI-----CTFSRE-GEGACH 213
            :||||...  |.|:...:|...:|.|   ::|...:     .|.|.:     |..::. |..:|.
  Fly   156 SGWGSTSI--SQMQPEKRLRYTVVHLRDQNQCARNY-----FGAGTVTNTMFCAGTQAGGRDSCQ 213

  Fly   214 GDSGGPLVS--NG--QLVGVVNWGRPCGVGL-PDVQANVYYYLDWI 254
            ||||||||:  :|  :|.|:|:||..|...: |.:...|..|.|||
  Fly   214 GDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 79/236 (33%)
Tryp_SPc 39..257 CDD:238113 79/235 (34%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 79/236 (33%)
Tryp_SPc 32..262 CDD:238113 80/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.