DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG11192

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:253 Identity:85/253 - (33%)
Similarity:122/253 - (48%) Gaps:28/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GPFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVEN-FIPALVNV 90
            |..|....|||.|||.|.|...|||||:| :.|.|.|||||:..:.::||.||.|: :..|...|
  Fly    18 GATPTPGDGRIVGGEVATIQEFPYQVSVQ-LQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTV 81

  Fly    91 ITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIAL------PTRPV 149
            ..|:::....|.:.....:..|..|:.....||:||:.|...:.|.|..||:.|      ||...
  Fly    82 RVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADT 146

  Fly   150 QLGEEIVLTGWG-----SDVA--YGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSRE 207
            :|    .::|||     |.|:  .|.|.: |..:.|.||..::|...:::...:....||. :|.
  Fly   147 RL----QVSGWGFQAEESAVSGEVGVSPQ-LRFVDVDLVESNQCRRAYSQVLPITRRMICA-ARP 205

  Fly   208 GEGACHGDSGGPLV------SNGQLVGVVNWGRPC-GVGLPDVQANVYYYLDWIRSKL 258
            |..:|.||||||||      ...:|.|:|:||..| ....|.|..||..:..||..:|
  Fly   206 GRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 79/238 (33%)
Tryp_SPc 39..257 CDD:238113 79/238 (33%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 79/238 (33%)
Tryp_SPc 28..262 CDD:238113 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.