DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG10764

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:286 Identity:86/286 - (30%)
Similarity:134/286 - (46%) Gaps:47/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLRLSLLILLAVKPPNPCESKRIVGPF---PAGQSGR--IKGGEEAEIGFAPYQVSLQPIVGSHN 62
            |:.::||.||.:     |.::.....|   |.|.|.|  |.||::|.   .|..:.:..|..|.:
  Fly     4 LVSVALLSLLTL-----CVTENEHFKFLETPCGISTRPKISGGDDAA---EPNSIWMAAIFNSSD 60

  Fly    63 --CGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIA 125
              |||.|::..::::|.||:.......|.:  |.....||.|::....:..|..:......|||.
  Fly    61 FQCGGTIIHMRFVLSAAHCLVRGYDLYVRL--GARNINEPAAVHTVINVFVHHDFIASEYRNDIG 123

  Fly   126 LVKLTENITFNELTQPIALPTRPVQLGE-EIVLT----GWGSDVAYGSSMEDLHKLTVGLVPL-- 183
            |::|:|:|.:....|||.:...|...|. |.:.|    |||:.....|.|..    |:.|:.|  
  Fly   124 LLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGKLSIMLQ----TIYLLHLKR 184

  Fly   184 DECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSN----------GQLVGVVNWGRP-C- 236
            :||....|  .::....||..::.|: .|.|||||||.:|          .|| |:|::|.| | 
  Fly   185 NECKRKLN--FNLNSRQICAGTKNGD-TCRGDSGGPLSTNILFPSNKSYEVQL-GIVSFGDPECR 245

  Fly   237 GVGLPDVQANVYYYLDWIRSKLSGNN 262
            |||   |..:|..|:|||.|.::.|:
  Fly   246 GVG---VYTDVTSYVDWISSTIARND 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 72/240 (30%)
Tryp_SPc 39..257 CDD:238113 72/238 (30%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 71/238 (30%)
Tryp_SPc 38..263 CDD:238113 73/240 (30%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.