DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and thetaTry

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:266 Identity:88/266 - (33%)
Similarity:129/266 - (48%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILLAVKPPNPCESKRIVG-----PFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAI 67
            ||:.|||  .:.|..  .||     ||.  :.|||.|||:..||..|||||||...|||.|||::
  Fly     7 LLVCLAV--GSACAG--TVGVSNGDPFE--REGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65

  Fly    68 LNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTEN 132
            :||:.::||.||:.....:.|.|..|:..:.|.|.:....|:..:..|:...|..|:.::||.|.
  Fly    66 INEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEK 130

  Fly   133 ITFNELTQPIALPTRPVQLGEEIVLTGWGSDVAYG--SSMEDLHKLTVGLVPLDEC--------- 186
            :...|..:.|.|.|.....|...|:|||||...:.  :..:.|.::.|.:|....|         
  Fly   131 VKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGE 195

  Fly   187 --YETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSNGQLVGVVNWGRPCGVG-LPDVQANVY 248
              |::.          :|.:.:: :.||.|||||||.....|||:|:||..|... ||.|.::|.
  Fly   196 IIYDSM----------VCAYEKK-KDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVP 249

  Fly   249 YYLDWI 254
            ....||
  Fly   250 ALRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 75/231 (32%)
Tryp_SPc 39..257 CDD:238113 75/230 (33%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 75/231 (32%)
Tryp_SPc 35..255 CDD:238113 74/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.