DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG9377

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:261 Identity:70/261 - (26%)
Similarity:110/261 - (42%) Gaps:57/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EEAEIGFAPYQVSLQPIVGS--HNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAI 103
            :||:.|..|:.|:   :.||  :.|.||::....:||..|||:|.....|.::.|  :|  ..|:
  Fly   105 QEAKFGEFPWLVA---VYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAG--EW--DAAV 162

  Fly   104 YYTAEIHK---------HCMYDQ-PYMHNDIALV--------KLTENITFNELTQPIALPTRPVQ 150
            ....:.|:         |..|.| |..|| ||::        :|..|:      |||.||...:.
  Fly   163 ELEPQPHQQRSVVETLVHPNYTQMPLAHN-IAILLVDKEKPFQLAPNV------QPICLPPPRIM 220

  Fly   151 LG-EEIVLTGW-GSDVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGH------ICTFSRE 207
            .. .:..::|| .||  :|.:.....:.|:.::|.|:| .|..|.|.:|..|      :|....:
  Fly   221 YNYSQCYVSGWQRSD--FGRAAILPKRWTLYVLPPDQC-RTKLRLSLLGRRHAHNDSLLCAGGDK 282

  Fly   208 GEGACHGD---SGGPLV-------SNGQLVGVVNWGRPC-GVGLPDVQANVYYYLDWIRSKLSGN 261
            |:..| ||   :..||:       ....|.|::.....| |..|..:..||..|..||..||...
  Fly   283 GDFVC-GDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWIDLKLRER 346

  Fly   262 N 262
            |
  Fly   347 N 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 65/251 (26%)
Tryp_SPc 39..257 CDD:238113 67/254 (26%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 66/252 (26%)
Tryp_SPc 105..339 CDD:214473 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.