DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Try29F

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:230 Identity:78/230 - (33%)
Similarity:118/230 - (51%) Gaps:7/230 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAE 99
            |||.||:.|.|...|||||||.  ..|.|||:::.:.|::||.||.|.....|..|..|:::.:.
  Fly    40 GRIVGGQVANIKDIPYQVSLQR--SYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSV 102

  Fly   100 PGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQL--GEEIVLTGWGS 162
            .|.:.....:|:|..:|...:..|.:|::|.|....|.....:.||.:...:  |..::::|||:
  Fly   103 GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGN 167

  Fly   163 DVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSRE-GEGACHGDSGGPLVSNGQL 226
            ..:...:...|..:||..|...:|.|.:....|:....:|....| |:.||.|||||||.::|.|
  Fly   168 TQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVL 232

  Fly   227 VGVVNWGRPCG-VGLPDVQANVYYYLDWIRSKLSG 260
            .|||:||..|. ...|.|.:.|....||| |.:||
  Fly   233 WGVVSWGYGCARPNYPGVYSRVSAVRDWI-SSVSG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 72/221 (33%)
Tryp_SPc 39..257 CDD:238113 72/221 (33%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 72/221 (33%)
Tryp_SPc 42..264 CDD:238113 74/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.