DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:268 Identity:85/268 - (31%)
Similarity:128/268 - (47%) Gaps:33/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRLSLLIL-LAVKPPNPCESKRIVGPFPAGQ--SGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGG 65
            :::.|.|| |||...:..:.|..|...|...  .|||..|..|..|.|||.|.| ...|...|||
  Fly     1 MKVFLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGL-GFSGGWWCGG 64

  Fly    66 AILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHN---DIALV 127
            :|:..:|::||.||:.:....:|..          ||.:.|.....|.:.:..::.:   ||||:
  Fly    65 SIIAHDWVLTAEHCIGDAASVIVYF----------GATWRTNAQFTHTVGNGNFIKHSNADIALI 119

  Fly   128 KLTENITFNELTQPIALPTRPVQLGEE----IVLTGWGSDVAY-GSSMED-LHKLTVGLVPLDEC 186
            :: .::.|..:...:.||:...:....    .|..|||.  .| ||.:.| |..:.:.:|..:||
  Fly   120 RI-PHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGG--TYDGSPLPDWLQCVDLQIVHNEEC 181

  Fly   187 YETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSN--GQLVGVVNW--GRPCGVGLPDVQANV 247
            ..|:   .|:|...|||.:.:|:..|.||||||||::  .:||||.|:  ...|..|.|.....|
  Fly   182 GWTY---GSVGDNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGCQSGAPAGFQRV 243

  Fly   248 YYYLDWIR 255
            .|:|||||
  Fly   244 TYHLDWIR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 72/230 (31%)
Tryp_SPc 39..257 CDD:238113 73/230 (32%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 72/230 (31%)
Tryp_SPc 37..253 CDD:238113 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.