DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG31954

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:266 Identity:95/266 - (35%)
Similarity:140/266 - (52%) Gaps:15/266 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLRLSLLILLAV-KPPNPCESKR-----IVGPFPAGQ--SGRIKGGEEAEIGFAPYQVSLQPIVG 59
            ||:.|||:|..| ..|.|.:.:|     |..|:....  .|||.||....|..||:|||||  ..
  Fly     9 LLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQ--TS 71

  Fly    60 SHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDI 124
            ||.|||:|::|.||:||.||........:.|..||:::|..|.:....:|.:|..::...:..|.
  Fly    72 SHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDF 136

  Fly   125 ALVKLTENITFNELTQPIALPTRPVQL--GEEIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDECY 187
            :|::|...|.|:|..:.:.||...::.  ||...::|||:......|.|.|.::.|.||..:.|.
  Fly   137 SLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCS 201

  Fly   188 ETFNRTSSMGVGHICT-FSREGEGACHGDSGGPLVS-NGQLVGVVNWGRPCG-VGLPDVQANVYY 249
            |.:.:...:....||. |...|:.||.||||||:|| :|:|||||:||..|. ...|.|.:.|.:
  Fly   202 EKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSF 266

  Fly   250 YLDWIR 255
            ..|||:
  Fly   267 ARDWIK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 80/222 (36%)
Tryp_SPc 39..257 CDD:238113 80/222 (36%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 80/222 (36%)
Tryp_SPc 51..274 CDD:238113 81/224 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.