DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and Ser12

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:229 Identity:81/229 - (35%)
Similarity:111/229 - (48%) Gaps:12/229 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AGQS-GRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGT 94
            ||.| .||.||....|...|:|.:|. ....:.||..|.::..||||.||||.....|.:|..| 
  Fly    17 AGSSPERIVGGHPVLISEVPWQAALM-YSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVG- 79

  Fly    95 NKWAEPGAIY-YTAEIHKHCMY-DQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIVL 157
            :.|...|..: ..|.|.||..| ....:.||||:::|.:.:.||...:||.|.......|.|..:
  Fly    80 SVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASV 144

  Fly   158 TGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFNR-TSSMGVGHICTFSREGEGACHGDSGGPLV 221
            :|||...........|.|.:|.::..:.|..::.. |.:|    ||..:.. :.:||||||||||
  Fly   145 SGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQYITKTM----ICAAALL-KDSCHGDSGGPLV 204

  Fly   222 SNGQLVGVVNWGRPC-GVGLPDVQANVYYYLDWI 254
            |.|||||:|::|..| ....|.|.|||.....||
  Fly   205 SGGQLVGIVSYGIGCANPFFPGVYANVAELKPWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 76/221 (34%)
Tryp_SPc 39..257 CDD:238113 76/220 (35%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 76/221 (34%)
Tryp_SPc 24..238 CDD:238113 75/220 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.