DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and psh

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:253 Identity:68/253 - (26%)
Similarity:114/253 - (45%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IKGGEEAEIGFAPYQVSLQPIV--GSHNCGGAILNENWIITAGHCV--ENFIPALVNVITGTNKW 97
            |.||...:.|..|:..::..|.  ....|||:::...:::||.|||  :...||.|.:  |....
  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRL--GAVNI 206

  Fly    98 AEPGAIYYTAEIHKHCMYDQPYM---HNDIALVKLTENITFNELTQPIALPTRPVQ--LGEEIVL 157
            ..|...|....|....::.| |:   :||||:::|..::...:..:|..|.|....  ...:..:
  Fly   207 ENPDHSYQDIVIRSVKIHPQ-YVGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFV 270

  Fly   158 TGWG-SDVAYGSSMEDLHKLTVGLVPLDECYETFN------RTSSMGV--GHICTFSRE-GEGAC 212
            .||| .:|...:..:.|.:..:.|||||:|..::.      |....||  ..:|...:: ...||
  Fly   271 AGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADAC 335

  Fly   213 HGDSGGPL-----VSNGQ--LVGVVNWGRPCGVGLPDVQANVYYYLDWIRSKLSGNNK 263
            .|||||||     |.:|.  ::||::.|..|....|.:...|..|||:|...:..:|:
  Fly   336 KGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIVWPDNR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 66/242 (27%)
Tryp_SPc 39..257 CDD:238113 66/243 (27%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 66/242 (27%)
Tryp_SPc 144..387 CDD:238113 67/245 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.