DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG31220

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:296 Identity:77/296 - (26%)
Similarity:123/296 - (41%) Gaps:50/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLSLLILLAVKPPNPCESKRIVGPFP-AGQ---SGRIKGGEEAEIGFAPYQVSL----------- 54
            |...:.:...||.|...|      :| .|:   :.|:.||.|..:...|:...|           
  Fly    74 RYKRIYICCPKPANTLPS------YPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPD 132

  Fly    55 QPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWA------EPGAIYYTAEIH--- 110
            :.:|.|  |||:::|..:::||.|||.:.:..:..|..|.:..:      ..||....|..|   
  Fly   133 RELVPS--CGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDI 195

  Fly   111 ------KHCMYDQP--YMHNDIALVKLTENITFNELTQPIALPTRPVQLGE-EIVLTGWGSDVAY 166
                  .|..||..  ...||||||:|.|.:.:.....||.:...|..|.: ::.:.|||....:
  Fly   196 DVESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMYVAGWGKTGMF 260

  Fly   167 GSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLV-SNGQ----- 225
            .:..:.|....|.:...:||.|.:..........||....:..|.|.||||.||: ::|:     
  Fly   261 DTGSKVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETI 325

  Fly   226 --LVGVVNWGRPCG-VGLPDVQANVYYYLDWIRSKL 258
              |.|:.::|.||| :|.|.|......:..|||:.|
  Fly   326 TFLAGITSYGGPCGTIGWPSVFTRTAKFYKWIRAHL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 66/255 (26%)
Tryp_SPc 39..257 CDD:238113 68/255 (27%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 66/255 (26%)
Tryp_SPc 104..360 CDD:238113 68/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.