DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG8952

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:283 Identity:78/283 - (27%)
Similarity:127/283 - (44%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LSLLILLAVKPPNPCESKRIVG-PF-PAGQS-----GRIKGGEEAEIGFAPYQVSLQPIVGSH-N 62
            |.|::|.|:.         :|| || ||..|     .||..|.:|::|..|:||.|:...... .
  Fly     9 LMLVLLAAIS---------VVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLL 64

  Fly    63 CGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTA-EIHKHCMYDQPYMHNDIAL 126
            |||:|:::.|::||.||....  :.:.::.||.......|:..|: .|..|..|:.. ::||::|
  Fly    65 CGGSIISDTWVLTAAHCTNGL--SSIFLMFGTVDLFNANALNMTSNNIIIHPDYNDK-LNNDVSL 126

  Fly   127 VKLTENITFNELTQPIALPTRPVQLGEEI-------VLTGWG-SDVAYGSSMEDLHKLTVGLVPL 183
            ::|.|.:||:...|.|.|..   |.|:.|       .:.|:| ::..|....|.|....|.::..
  Fly   127 IQLPEPLTFSANIQAIQLVG---QYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDN 188

  Fly   184 DECYETFNR----TSSMGVGHICTFSREGE--GACHGDSGGPL------VSNGQLVGVVNW--GR 234
            .:|...:.:    .|:|     |....:|.  ..|.|||||||      :...|.:|:.::  ..
  Fly   189 ADCVAIYGKYVVVDSTM-----CAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAED 248

  Fly   235 PCGVGLPDVQANVYYYLDWIRSK 257
            .|...||...|.|..:|.:|..|
  Fly   249 QCTYRLPSGYARVSSFLGFIADK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 65/241 (27%)
Tryp_SPc 39..257 CDD:238113 64/241 (27%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 65/241 (27%)
Tryp_SPc 38..271 CDD:238113 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.