DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG11664

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:199 Identity:54/199 - (27%)
Similarity:94/199 - (47%) Gaps:19/199 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GAILNENWIITAGHCV-ENFIPALVNVITGTN--KWAEPGAIYYTAEIHKHCMYDQPYMHNDIAL 126
            |::.:..:::|..||. :|..|..::|..|..  .|...|.  ..|.:.:|..:....:.||||:
  Fly    49 GSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGK--QVAGLLRHPKFSPLTLRNDIAV 111

  Fly   127 VKLTENITFNELTQPIALPTRPV----QLGEEIVLTGWG-SDVAYGSSMEDLHKLTVGLVPLDEC 186
            :::...|:.:.:...|.|.:||:    .......|.||. ..:|     :.|..::|.:.|...|
  Fly   112 LRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNLMHIA-----QPLKSMSVQVEPEKNC 171

  Fly   187 YETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSNGQLVGVVNWGRPCG-VGLPDVQANVYYY 250
            .:.|.:.|.   |.||..:..|||.|:||||.||:|.|::.|:....|.|| ...|.:..:|:|:
  Fly   172 RQWFPQISG---GVICASATMGEGLCYGDSGDPLISGGEVCGLAIAFRKCGDKRYPALFTDVHYH 233

  Fly   251 LDWI 254
            ..:|
  Fly   234 RAFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 53/197 (27%)
Tryp_SPc 39..257 CDD:238113 54/199 (27%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 54/199 (27%)
Tryp_SPc 38..237 CDD:214473 53/197 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.