DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG18636

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:226 Identity:61/226 - (26%)
Similarity:101/226 - (44%) Gaps:36/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKW--- 97
            ||..|..|:...:|:.|.|........|||:::.:..::||.||   || |..:::....::   
  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC---FI-ANQHLVARLGEYERT 104

  Fly    98 -AEPGAIYYT--AEIH------KHCMYDQPYMH-NDIALVKLTENITFNELTQPIALP------- 145
             :|....||.  .|.|      ||.:|| |..| ||||:::|::::.:.:..:||.:.       
  Fly   105 RSEECTGYYCNFREEHMVDAGFKHKLYD-PNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRH 168

  Fly   146 -TRPVQLGEEIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSREGE 209
             ...:.|   :..||||. ....|..:.|..|.:...|.|.|.:...:|  :.....|..:.: .
  Fly   169 YLDKIDL---LTATGWGK-TQMESDSDALQTLDIRRQPPDVCAKFIGQT--IAGNQFCAGNWD-S 226

  Fly   210 GACHGDSGGPLVSNGQLVGVVNWGRPCGVGL 240
            ..|:|||||||   |.::...|..|...||:
  Fly   227 NLCNGDSGGPL---GAVITHKNTQRFVQVGI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 61/226 (27%)
Tryp_SPc 39..257 CDD:238113 59/223 (26%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 61/226 (27%)
Tryp_SPc 45..278 CDD:238113 60/225 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.