DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG30323

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:241 Identity:54/241 - (22%)
Similarity:86/241 - (35%) Gaps:53/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SHNCGGAILNENWIITAGHCVENFIPALVN---------VITGTNKWAE---PGAIYYTAEIHKH 112
            :|.|.|::|:..|::|:|.||.....:..|         |:..|.|..:   |..||:..:|   
  Fly    51 NHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKI--- 112

  Fly   113 CMYDQPYMH--NDIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTGWGS----DVAYGSSM- 170
             :.|:..:.  .::||:||...:|.....  :.||.:.:.........|||.    ...|.|:| 
  Fly   113 -VLDESAISGCTELALLKLDRGVTGQRFA--MMLPEKELNSTWLCNSLGWGRIYYVSYVYISAMC 174

  Fly   171 --------------------EDLHKLTVGLVPLDECYETFNRTSSMGVGHICTFSREGEG-ACHG 214
                                .:|.::....:...||....:|.       :|..|..|.| .|..
  Fly   175 PAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRC-------LCMTSYTGRGNMCQQ 232

  Fly   215 DSGGPLVSNGQLVGVVNWGRPCGVGLPDVQANVYYYLDWIRSKLSG 260
            |.|.||..:..|.||......|.........|:|....:|...|||
  Fly   233 DLGSPLFCDHFLYGVARRVHTCDDEGFMFYTNIYQNRKFIEDTLSG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 50/233 (21%)
Tryp_SPc 39..257 CDD:238113 51/236 (22%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 51/236 (22%)
Tryp_SPc 45..272 CDD:214473 50/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.