DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG30286

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:282 Identity:72/282 - (25%)
Similarity:121/282 - (42%) Gaps:42/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILLAVKPPNPCESKRIVGPFPAGQSGRIKGGEE--AEIGFAPYQVSLQPIVGSHNCGGAILNE 70
            :|:|.::.|.:|..:.:.:.|.....|......||  |.|..:|:...|.. .|...|||.::|.
  Fly     4 ILLLTSLLPWHPHATAQFLEPDCGYMSPEALQNEEHQAHISESPWMAYLHK-SGELVCGGTLVNH 67

  Fly    71 NWIITAGHCV---ENF------IPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIAL 126
            .:|:||.||:   ||.      ..:|.::....:....|...:......:|..|.:....:||.|
  Fly    68 RFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGL 132

  Fly   127 VKLTENITFNELTQPIALPTR-----PVQLGEEIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDEC 186
            ::|.:::.:....:||.|.|.     .::....:|.||||...:..:: ..|..:.|..|....|
  Fly   133 LRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSEAAN-HILKSIRVTRVNWGVC 196

  Fly   187 YETF---NRTSSMGVGHICTFSREGEGACHGDSGGPLVSNGQL-----------VGVVNWGRPCG 237
            .:|:   .|...:.|.|      |...:|.||||||:   ||.           ||:|::|....
  Fly   197 SKTYWVDRRRDQICVSH------ESGVSCSGDSGGPM---GQAIRLDGRVLFVQVGIVSYGNAEC 252

  Fly   238 VGLPDVQANVYYYLDWIRSKLS 259
            :. |.|..||..::|||.:.||
  Fly   253 LS-PSVFTNVMEHIDWIMAALS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 62/247 (25%)
Tryp_SPc 39..257 CDD:238113 64/247 (26%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 61/241 (25%)
Tryp_SPc 39..268 CDD:214473 60/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.