DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG30098

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:258 Identity:63/258 - (24%)
Similarity:101/258 - (39%) Gaps:63/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIKGGEEAEIGFAPYQVSLQPIVGSHN--CGGAILNENWIITAGHCV---ENFIPALVNVITGTN 95
            |:.||:.|.  ..|:...|   :..:.  |||:::...:::||.||.   :|....|....:...
  Fly    36 RVIGGQNAR--RTPWMAYL---IRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRT 95

  Fly    96 KWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIA--LPTRPVQLGEEI--- 155
            ...:..: |....|::|..|.. :.::|||::||...:.::...:||.  |.:....|...|   
  Fly    96 TDGQTRS-YRVVSIYRHKNYID-FRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNF 158

  Fly   156 VLTGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVG--HICTFSREGEGACHGDSGG 218
            .|||||....|......|.::::..|..:.|          ||.  .||.:: ..:.||.|||||
  Fly   159 TLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC----------GVPSLSICCWN-PVQYACFGDSGG 212

  Fly   219 PLVSNGQLV-----------GVVNWGRPCGVGLPDVQAN---------VYYYLDWIRSKLSGN 261
            ||   |.||           ||.|          .|..|         :..|:.|:...|..|
  Fly   213 PL---GSLVKYGHKTIYVQFGVTN----------SVTGNCDGYSSYLDLMSYMPWLYQTLLRN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 60/249 (24%)
Tryp_SPc 39..257 CDD:238113 60/249 (24%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 60/248 (24%)
Tryp_SPc 37..258 CDD:238113 60/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.