DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG30090

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:260 Identity:74/260 - (28%)
Similarity:112/260 - (43%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITG------- 93
            :|.||.:|.|...|:...:...| ...|||.::.:.:::||.|||..  .:.|.|..|       
  Fly    39 KIIGGRDAIINSNPWMAYIHSSV-KLICGGTLITQRFVLTAAHCVNE--GSAVKVRLGEYDDTAT 100

  Fly    94 ---TNKWAEPGAIYYTAEI-HKHCMYDQPYMHNDIALVKLTENITFNELTQPIA--LPTRPVQLG 152
               .:|...|.|..:..:: .:|..:.:....|||||::|.:.:||.....||.  |.|...:|.
  Fly   101 EDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELV 165

  Fly   153 EEI---VLTGWGSDVAYGSSMEDLHKLTVGLVPL--------DECYETFNRTSSMGVGHICTFSR 206
            :.|   |.||||         |.....|.|::.:        .:|.:...|....  ..||. .|
  Fly   166 DSIEWFVATGWG---------ETRTHRTRGVLQITQLQRYNSSQCMQALGRLVQQ--NQICA-GR 218

  Fly   207 EGEGACHGDSGGPLVSNGQLV--------GVVNWG-RPC-GVGLPDVQANVYYYLDWIRSKLSGN 261
            .|...|:|||||||....:.:        |||::| |.| |:|   |..:||.|.|||.:.:..|
  Fly   219 LGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIG---VYTDVYSYADWIATVVQQN 280

  Fly   262  261
              Fly   281  280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 71/251 (28%)
Tryp_SPc 39..257 CDD:238113 72/251 (29%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 71/251 (28%)
Tryp_SPc 40..276 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.