DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG30087

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:245 Identity:81/245 - (33%)
Similarity:107/245 - (43%) Gaps:39/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPAL------VNVIT-- 92
            |:..|:||.|..||:.|.:.....:| |||:|||..:|:||.|||   .|.|      .|:.|  
  Fly    41 RVVNGKEAVIRSAPFMVYVTNNSLTH-CGGSILNSRYILTAAHCV---FPNLRLRLGEHNIRTDP 101

  Fly    93 ---GTNKWAEPGAIYY-TAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGE 153
               |:|  ..|.:..| ..:...|..|:.....|||||:||..:|.||...|||.:...|.....
  Fly   102 DCQGSN--CSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASAPS 164

  Fly   154 EIVLT----GWGSDVAYGSSMEDLHKL-TVGLVPLDECYETFNRTSSMGVGHICTFSREGEGACH 213
              |.|    |||.....|..    |.| |..|...|..|.:.:..:.|....||. ..|....|.
  Fly   165 --VATYQTFGWGETKKNGFP----HLLQTAELRAYDAAYCSRSFHAYMNGNQICA-GHEERDTCA 222

  Fly   214 GDSGGPLVSNGQL--------VGVVNWGRPCGVGLPDVQANVYYYLDWIR 255
            ||||||||:....        :|:|::| |.....|.|...|..|::|||
  Fly   223 GDSGGPLVTRVDFDGVKRYLQLGIVSYG-PTDCQSPGVYTYVPNYINWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 78/242 (32%)
Tryp_SPc 39..257 CDD:238113 80/242 (33%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 78/242 (32%)
Tryp_SPc 42..272 CDD:238113 80/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.