DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and try-5

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:247 Identity:56/247 - (22%)
Similarity:85/247 - (34%) Gaps:72/247 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CGGAILNENWIITAGHCVENFIPAL-----VNVITGTNKWAEPGAIYYTAEI------------- 109
            |||.::....::||.||.:....|.     .|.::|  ::.|....:..:||             
 Worm    73 CGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSG--RYCESNQRFTDSEILTRTVVTVGAMCT 135

  Fly   110 -----------------------------HKHCMYDQPYMHNDIALVKLTENITFNELTQPIALP 145
                                         ..||     ...|||.:::|...|...|......||
 Worm   136 RLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHC-----EQGNDIVILELESTIDDVEGANYACLP 195

  Fly   146 TRP---VQLGEEIVLTGWGSDVAYG---SSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICTF 204
            ..|   :|.|..:...|||||...|   ::...:..||:....|..|.|  |..:|:.....||.
 Worm   196 FLPEVNIQSGANVTSFGWGSDPGKGFDNAAFPMIQVLTLATETLATCEE--NWGTSIPFDSFCTA 258

  Fly   205 SREGEGACHGDSGGPLVSNGQ------LVGVVNWGRPC----GVGLPDVQAN 246
            ..|.:..|.|||||.|..:..      ::.:|::|..|    |...|..|.|
 Worm   259 EEEDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYGSDCVQLIGGSEPRSQIN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 56/247 (23%)
Tryp_SPc 39..257 CDD:238113 56/247 (23%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 51/231 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.