DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and PRSS36

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:305 Identity:83/305 - (27%)
Similarity:119/305 - (39%) Gaps:72/305 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILLAVKP----------------PNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSLQPI 57
            |::|.:.|                |...:..|   |.|   |.||.||..|:.|..|:||||.. 
Human     9 LVMLVISPIPGAFQDSALSPTQEEPEDLDCGR---PEP---SARIVGGSNAQPGTWPWQVSLHH- 66

  Fly    58 VGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIY------------------ 104
            .|.|.|||:::..:|:::|.||   |:         ||...||.|.:                  
Human    67 GGGHICGGSLIAPSWVLSAAHC---FM---------TNGTLEPAAEWSVLLGVHSQDGPLDGAHT 119

  Fly   105 -YTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQL--GEEIVLTGWGSDVAY 166
             ..|.|.....|.|..:..|:||::|....:......|:.||....:.  |.....|||| ||..
Human   120 RAVAAIVVPANYSQVELGADLALLRLASPASLGPAVWPVCLPRASHRFVHGTACWATGWG-DVQE 183

  Fly   167 GSS------MEDLHKLTVGLVPLDECYE---TFNRTSSMGVGHICTFSREG-EGACHGDSGGPLV 221
            ...      ::::....:|.......|.   .||.|..:..|.:|....|| ...|.||||||||
Human   184 ADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLV 248

  Fly   222 --SNGQ--LVGVVNWGRPCG-VGLPDVQANVYYYLDWIRSKLSGN 261
              ..|:  ..|:.::|..|| ...|.|...|..|..|||.::.|:
Human   249 CEEGGRWFQAGITSFGFGCGRRNRPGVFTAVATYEAWIREQVMGS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 71/253 (28%)
Tryp_SPc 39..257 CDD:238113 72/253 (28%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 71/253 (28%)
Tryp_SPc 47..289 CDD:238113 73/255 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316 1/2 (50%)
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.