Sequence 1: | NP_650599.1 | Gene: | CG31265 / 42068 | FlyBaseID: | FBgn0051265 | Length: | 266 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005250003.1 | Gene: | PRSS37 / 136242 | HGNCID: | 29211 | Length: | 265 | Species: | Homo sapiens |
Alignment Length: | 254 | Identity: | 59/254 - (23%) |
---|---|---|---|
Similarity: | 98/254 - (38%) | Gaps: | 65/254 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 APYQVSLQPIVGSH--NCGGAILNENWIITAGHCVENFIPAL--------VNVITGTNKWAEPGA 102
Fly 103 IYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTG--WGSD-- 163
Fly 164 ------------VAYGSSMEDLHK---------------LTVGLVPLDECYET---FNRTSSMGV 198
Fly 199 GHICTFSR-EGEGACHGDSGGPLVSNGQLVGVVNWGRPCGVGLPDVQANVYYYLDWIRS 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31265 | NP_650599.1 | Tryp_SPc | 36..254 | CDD:214473 | 57/250 (23%) |
Tryp_SPc | 39..257 | CDD:238113 | 59/254 (23%) | ||
PRSS37 | XP_005250003.1 | Tryp_SPc | 28..261 | CDD:304450 | 58/253 (23%) |
Tryp_SPc | 28..258 | CDD:214473 | 56/249 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S8086 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |