DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and PRSS37

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_005250003.1 Gene:PRSS37 / 136242 HGNCID:29211 Length:265 Species:Homo sapiens


Alignment Length:254 Identity:59/254 - (23%)
Similarity:98/254 - (38%) Gaps:65/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 APYQVSLQPIVGSH--NCGGAILNENWIITAGHCVENFIPAL--------VNVITGTNKWAEPGA 102
            |||.|.|:    ||  .|.|.::..:|::...||   ::|.|        ..|..||.:...|  
Human    27 APYLVYLK----SHFNPCVGVLIKPSWVLAPAHC---YLPNLKVMLGNFKSRVRDGTEQTINP-- 82

  Fly   103 IYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTG--WGSD-- 163
                .:|.::..|......:|:.|:||.:....|...||:.|.|..|:.|...:|:|  |..:  
Human    83 ----IQIVRYWNYSHSAPQDDLMLIKLAKPAMLNPKVQPLTLATTNVRPGTVCLLSGLDWSQENS 143

  Fly   164 ------------VAYGSSMEDLHK---------------LTVGLVPLDECYET---FNRTSSMGV 198
                        :..|.::.|..:               |...::...||.:|   .:..:|:.|
Human   144 GLWQLEPPGHLTLHRGPAIPDWQRHNSHEQGRHPDLRQNLEAPVMSDRECQKTEQGKSHRNSLCV 208

  Fly   199 GHICTFSR-EGEGACHGDSGGPLVSNGQLVGVVNWGRPCGVGLPDVQANVYYYLDWIRS 256
            ..:..||| .||.|.     ..::...:|.| :..|...| |...:..|||.|:.||.:
Human   209 KFVKVFSRIFGEVAV-----ATVICKDKLQG-IEVGHFMG-GDVGIYTNVYKYVSWIEN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 57/250 (23%)
Tryp_SPc 39..257 CDD:238113 59/254 (23%)
PRSS37XP_005250003.1 Tryp_SPc 28..261 CDD:304450 58/253 (23%)
Tryp_SPc 28..258 CDD:214473 56/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8086
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.