DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31265 and CG43110

DIOPT Version :9

Sequence 1:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:269 Identity:79/269 - (29%)
Similarity:108/269 - (40%) Gaps:75/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PAGQS--GRIKGGEEAEIGFAPYQVSLQPIVGSHN-----CGGAILNENWIITAGHCVENFIPAL 87
            |.|::  .:|..|..|.      |.|.|.:.|..|     |||.|::|::::|..||...   ..
  Fly    27 PCGKTPVPKIISGSNAS------QQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAHCKST---QT 82

  Fly    88 VNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLG 152
            :.|..|......|.......|...|..|......||||||||..::.||...|||.:.. ...||
  Fly    83 LFVRLGAYNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHL-DATLG 146

  Fly   153 EEI---VLTGWG-------SDVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSM------GVG-- 199
            ::|   ...|||       ||:        |.::.|            |||:.|      |:.  
  Fly   147 KQIRYYNAFGWGRTRNAEQSDI--------LQRIFV------------NRTNPMICHLYLGMSPD 191

  Fly   200 --HICTFSREGEGACHGDSGGPLVSN--------GQLVGVVNWG-RPC-GVGLPDVQANVYYYLD 252
              .||..:.:|: .|.|||||||:|.        ....|:.::| |.| ||||   ..:|..|..
  Fly   192 PKQICATTDQGD-TCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGL---YTDVSQYSG 252

  Fly   253 WI----RSK 257
            ||    |||
  Fly   253 WIANIVRSK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 72/252 (29%)
Tryp_SPc 39..257 CDD:238113 74/256 (29%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 72/252 (29%)
Tryp_SPc 36..257 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.