DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and KLK4

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_004908.4 Gene:KLK4 / 9622 HGNCID:6365 Length:254 Species:Homo sapiens


Alignment Length:236 Identity:70/236 - (29%)
Similarity:122/236 - (51%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91
            |:.|::.:....|:|.:| .:.....|.|.::..:|:::|.||.:...|..|.:.: .....|||
Human    31 IINGEDCSPHSQPWQAAL-VMENELFCSGVLVHPQWVLSAAHCFQNSYTIGLGLHS-LEADQEPG 93

  Fly    92 AVYYPDAIYL-HCNYDSPKYQNDIGLLHLNESI----TFNALTQAVELPTSPFPRGASELVFTGW 151
            :.....::.: |..|:.|...||:.|:.|:||:    |..:::.|.:.||:    |.|.|| :||
Human    94 SQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSISIASQCPTA----GNSCLV-SGW 153

  Fly   152 GSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICA-YRQANIGACHGDSGGPLVH 215
            | ..|.|.:|:.||.|....::...|..:   |:.| ..|...|| ..|....:|:|||||||:.
Human   154 G-LLANGRMPTVLQCVNVSVVSEEVCSKL---YDPL-YHPSMFCAGGGQDQKDSCNGDSGGPLIC 213

  Fly   216 QGTLVGILNF-FVPCAQ-GVPDIFMNIMYYRDWMRQTMSGN 254
            .|.|.|:::| ..||.| |||.::.|:..:.:|:.:|:..:
Human   214 NGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 69/230 (30%)
Tryp_SPc 27..246 CDD:214473 68/226 (30%)
KLK4NP_004908.4 Tryp_SPc 31..250 CDD:238113 69/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.