DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Prss59

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001348859.1 Gene:Prss59 / 73481 MGIID:1920731 Length:251 Species:Mus musculus


Alignment Length:215 Identity:52/215 - (24%)
Similarity:88/215 - (40%) Gaps:11/215 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTS-RLQVATGTIRYAEPGAVYYPDAIY 100
            :.||.|.||:  ....|.|.:|..:|::||.||  ..||. ||.|....|:..:.....|...: 
Mouse    37 NVPYMVYLQS--SPEPCVGTLIDPQWVLTAAHC--SLPTKIRLGVYRPNIKNEKEQICNYSFTV- 96

  Fly   101 LHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQ 165
            :|.|:|:...:||:.|:.|:...|.|.....:.:...|.....|..:.|...:.....|.|..|.
Mouse    97 VHPNFDAKLLKNDLMLIKLSYPATINMYVGTIAIAMEPMAFNESCFIPTWTWNNYKNLSDPDILT 161

  Fly   166 RVQQQHLNSPAC-ESMMSAYEDLELGPCHICAYRQAN-IGACHGDSGGPLVHQGTLVGILNF-FV 227
            .:.:..|:...| :::....::..:.  .:|.....| :.|....|..|.:..|.:.|||:: ..
Mouse   162 WINEYSLSPSDCLDTLHQQKQETRIN--IMCIGHSLNAMSATKEVSAAPAICSGRVHGILSWGKA 224

  Fly   228 PCAQGVPDIFMNIMYYRDWM 247
            ..|.|....|..|..|..|:
Mouse   225 SVANGSKGFFTEIHPYARWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 52/215 (24%)
Tryp_SPc 27..246 CDD:214473 51/212 (24%)
Prss59NP_001348859.1 Tryp_SPc 37..244 CDD:389826 51/213 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.