DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Prss55

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:246 Identity:79/246 - (32%)
Similarity:111/246 - (45%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGY---PTSRLQVATGTIRYA 88
            |:.||.|..|:.|:|||:|. ...|.|||:|:|:.||:|..||....   ||. |:|..||....
Mouse    61 IIEGQEAELGEFPWQVSIQE-SDHHFCGGSILSEWWILTVAHCFYAQELSPTD-LRVRVGTNDLT 123

  Fly    89 EPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGS 153
            ..........|..|..:......|||.||.|.:.:|||.||..:.||..|.|....|....|||.
Mouse   124 TSPVELEVTTIIRHKGFKRLNMDNDIALLLLAKPLTFNELTVPICLPLWPAPPSWHECWVAGWGV 188

  Fly   154 QSAAG--SLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICA-YRQANIGACHGDSGGPLV- 214
            .::..  |:.:.|.:|..:.:....|..|..:     |....:|| |...:..||.|||||||| 
Mouse   189 TNSTDKESMSTDLMKVPMRIIEWEECLQMFPS-----LTTNMLCASYGNESYDACQGDSGGPLVC 248

  Fly   215 --------HQGTLVGILNFFVPCA-QGVPDIFMNIMYYRDWMRQTMSGNGK 256
                    :|   |||:::...|. :|.|.|:..:..|..|:.:.....||
Mouse   249 TTDPGSRWYQ---VGIISWGKSCGKKGFPGIYTVLAKYTLWIEKIAQTEGK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 77/238 (32%)
Tryp_SPc 27..246 CDD:214473 76/234 (32%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.