DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG17242

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:223 Identity:63/223 - (28%)
Similarity:95/223 - (42%) Gaps:22/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 APYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIYLH 102
            ||:|.|:| :...|.|||.|.|:..|:|...||:......:.|..|:.:....|.|...:.:.|.
  Fly    27 APWQASVQ-INDKHHCGGVIYSEDIILTIAECVRKARLEFISVRVGSAQENAGGTVLKVEKMRLQ 90

  Fly   103 CNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQRV 167
            .....|   :|:.:|.|...:..:...:|:.|.|.|...|.:..| :|||..||.......|.||
  Fly    91 VLGLRP---SDVAILQLRSPLYLDGGIRAIPLATIPLVPGTNASV-SGWGQLSAMNPSSEVLLRV 151

  Fly   168 QQQHLNSPACES-------MMSAYEDLELGPCHICAYRQANIG-ACHGDSGGPLVHQGTLVGILN 224
            ..:..:...|.:       :||..|        |||.....|. ||.|..|||||....|.|||:
  Fly   152 DVKIQDQLMCATNLALKGRLMSVGE--------ICAAPAGEIPYACQGFVGGPLVANNRLYGILS 208

  Fly   225 FFVPC-AQGVPDIFMNIMYYRDWMRQTM 251
            :...| ......::.||..::.|:..|:
  Fly   209 WQSACDVLNKSSVYANIAMFKVWIESTV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 62/220 (28%)
Tryp_SPc 27..246 CDD:214473 61/216 (28%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 62/220 (28%)
Tryp_SPc 24..232 CDD:214473 61/217 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.