DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG18754

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:252 Identity:54/252 - (21%)
Similarity:99/252 - (39%) Gaps:47/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAV 93
            |.:||...:.|:.|.|       |....:...|:::||.|||.|...::..:...::|..|... 
  Fly   108 GAENAELNEYPWMVLL-------LYENRLSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTT- 164

  Fly    94 YYPDAI----------------YLHCNYDSP--KYQNDIGLLHLNESITFNALTQAVELPTSPFP 140
               |.|                .:|..:.|.  .|:|||.||.|...:.:....|.:.|..:.||
  Fly   165 ---DCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFP 226

  Fly   141 RGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGAC 205
            .....|..:||....::.:|.:...:.:    |...|.:...::....    .:||..|.....|
  Fly   227 LQDLNLQISGWDPTKSSQTLITSTVKER----NPADCLNRYPSFRSAS----QVCAGGQRKGDTC 283

  Fly   206 HGDSGGP---LVHQGT-----LVGILNFFVP-C-AQGVPDIFMNIMYYRDWMRQTMS 252
            .|.||.|   ::..|.     |.||.::... | :.|:|.::..|.::.:|::..::
  Fly   284 AGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 54/248 (22%)
Tryp_SPc 27..246 CDD:214473 53/244 (22%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 54/248 (22%)
Tryp_SPc 108..335 CDD:214473 53/245 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.