DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG34458

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:254 Identity:76/254 - (29%)
Similarity:128/254 - (50%) Gaps:12/254 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLARFLFYILVFSSLYCDL-LALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIIT 65
            :|.:....:|..:.::.|: :|.|..|:|||.||.|..|:||||| |.|.|.|||::|||..|:|
  Fly     6 NLVKLSILLLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQ-LNGRHHCGGSLISDTMIVT 69

  Fly    66 AGHCVKGYPTSRLQVATGTIRY-AEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALT 129
            |.||..|....:::...||... |..|..:......:|..|:......|:.|:.|:..:......
  Fly    70 AAHCTMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAV 134

  Fly   130 QAVELPTSPFPRGASEL-VFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLE-LGPC 192
            |.::|..|.....|..: :.:|:|:.:....||::|:..|.|..:...|.|     :::. |...
  Fly   135 QTIQLADSDSNYAADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNS-----QNIPGLTDR 194

  Fly   193 HICA-YRQANIGACHGDSGGPLVHQGTLVGILNFFVPC-AQGVPDIFMNIMYYRDWMRQ 249
            .:|| :....:.:|.|||||||...|.|.|::::...| |:|.|.::..:...|.|::|
  Fly   195 MVCAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 71/228 (31%)
Tryp_SPc 27..246 CDD:214473 69/223 (31%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 69/225 (31%)
Tryp_SPc 32..254 CDD:238113 71/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.