DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG34409

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:277 Identity:76/277 - (27%)
Similarity:121/277 - (43%) Gaps:63/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LEHFIVGGQNAAEGDAPY--QVSLQTLLGSHL---CGGAIISDRWIITAGHCVKGYPTSRLQ--- 79
            :|..::||..|:.|..|:  :::.:....|.:   |.|::||...|:||.|||... .|.|:   
  Fly   246 VESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNL-VSDLELSH 309

  Fly    80 VATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELP-TSPFPRGA 143
            |..|:...|.|.|:   :.:.:|.|||.|||.|||.||.:|.:   |.....:.|| ..|...|.
  Fly   310 VRLGSQDGATPFAI---EQVIVHPNYDQPKYANDIALLRINST---NGTFTPICLPFNGPITLGN 368

  Fly   144 SEL----VFTGWG------------SQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLE---- 188
            ..:    |..||.            |.|.||     ::.::...:|:.:|   ..||..|.    
  Fly   369 RLIGQIGVAAGWSIGSTENNSSMDPSNSTAG-----VRFIRLPIVNTTSC---AIAYASLSENFQ 425

  Fly   189 ----LGPCHICAYRQANIGACHGDSGGPLVHQG-----------TLVGILNFFVPCAQGV---PD 235
                :.|.|:||........|.||||||.:..|           |::||: .|.|...||   |.
  Fly   426 QPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIV-AFGPTLCGVTTIPG 489

  Fly   236 IFMNIMYYRDWMRQTMS 252
            ::..:..:.||:.::::
  Fly   490 VYTLVSSFSDWILRSIA 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 75/269 (28%)
Tryp_SPc 27..246 CDD:214473 73/265 (28%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 74/267 (28%)
Tryp_SPc 252..501 CDD:238113 74/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.