DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and KLK10

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:249 Identity:64/249 - (25%)
Similarity:95/249 - (38%) Gaps:45/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVY 94
            |...|.|..|:||||...|..| |.|.::...|::||.||  |......:|....:...:...:.
Human    49 GSPCARGSQPWQVSLFNGLSFH-CAGVLVDQSWVLTAAHC--GNKPLWARVGDDHLLLLQGEQLR 110

  Fly    95 YPDAIYLHCNYDSPKY-------------QNDIGLLHLNESITFNALTQAVELPTSPFPRGASEL 146
            ......:|     |||             ::|:.||.|...:......:|::||......| .:.
Human   111 RTTRSVVH-----PKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPG-DQC 169

  Fly   147 VFTGWGSQSAAGSLPSQLQRVQQQH---------LNSPACESMMSAYEDLELGPCHICAYRQANI 202
            ...|||:.:|        :||:...         |:...||..........:    |||......
Human   170 QVAGWGTTAA--------RRVKYNKGLTCSSITILSPKECEVFYPGVVTNNM----ICAGLDRGQ 222

  Fly   203 GACHGDSGGPLVHQGTLVGILNFFV-PCAQGV-PDIFMNIMYYRDWMRQTMSGN 254
            ..|..|||||||...||.|||::.| ||.... |.::..|..|..|:.:.:..|
Human   223 DPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 63/243 (26%)
Tryp_SPc 27..246 CDD:214473 62/239 (26%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 63/243 (26%)
Tryp_SPc 49..269 CDD:214473 62/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.