DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:232 Identity:67/232 - (28%)
Similarity:107/232 - (46%) Gaps:24/232 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVA-----TGTIR 86
            |:|||........||.|:| ....|.|||.:|..:|:::|.||.:  |:..::|.     ...|.
Zfish    24 IIGGQEVQPYSIKYQASVQ-YNNYHYCGGTLIHPQWVVSAAHCWR--PSYLIKVVLSEHDLSKIE 85

  Fly    87 YAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTS-PFPRGASELVFTG 150
            ..|  .|:......:|..|:...:.:||.||.|.:....:|..|...||.| |..:|.:..:.:|
Zfish    86 GFE--RVFNVSKALVHYMYNYRTFDSDIMLLKLEKPAELSATIQPAVLPVSVPALQGGTVCIVSG 148

  Fly   151 WG-SQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIG---ACHGDSGG 211
            || :|..:..|...|:.|..|.:  |.|:    .|....:....:||  .:.:|   :|.|||||
Zfish   149 WGVTQVYSYYLSPVLRAVDVQII--PQCQ----YYYYYRITDNMVCA--GSPLGGKDSCQGDSGG 205

  Fly   212 PLVHQGTLVGILNFFVPCAQG-VPDIFMNIMYYRDWM 247
            ||:..|...||:::.:.||.. .|.::..:..|..||
Zfish   206 PLICNGYFEGIVSWGISCANAYFPGVYTKVRNYIPWM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 67/232 (29%)
Tryp_SPc 27..246 CDD:214473 65/229 (28%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 65/229 (28%)
Tryp_SPc 24..241 CDD:238113 65/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.