DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and KLK7

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_005037.1 Gene:KLK7 / 5650 HGNCID:6368 Length:253 Species:Homo sapiens


Alignment Length:265 Identity:83/265 - (31%)
Similarity:130/265 - (49%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LARFL---FYILVFSSLYCDLLALE--------HFIVGGQNAAEGDAPYQVSLQTLLGSHL-CGG 55
            :||.|   ..||:.|      ||||        ..|:.|...|.|..|:||:|  |.|:.| |||
Human     1 MARSLLLPLQILLLS------LALETAGEEAQGDKIIDGAPCARGSHPWQVAL--LSGNQLHCGG 57

  Fly    56 AIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLN 120
            .::::||::||.||.....|..|...|...|.|:.   ......:.|..|.:..:.||:.|:.||
Human    58 VLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQR---IKASKSFRHPGYSTQTHVNDLMLVKLN 119

  Fly   121 ESITFNALTQAVELPTSPFPRGASELVFTGWGSQSAAG-SLPSQLQRVQQQHLNSPACESMMSAY 184
            .....:::.:.|.||:...|.|.:..| :|||:.::.. :.||.|..|..:.::...|..:   |
Human   120 SQARLSSMVKKVRLPSRCEPPGTTCTV-SGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKV---Y 180

  Fly   185 EDLELGPCHICA-YRQANIGACHGDSGGPLVHQGTLVGILNF-FVPCAQ-GVPDIFMNIMYYRDW 246
            :|| |....:|| ...:...||:||||||||.:|||.|:::: ..||.| ..|.::..:..:..|
Human   181 KDL-LENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKW 244

  Fly   247 MRQTM 251
            :..||
Human   245 INDTM 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 71/227 (31%)
Tryp_SPc 27..246 CDD:214473 70/223 (31%)
KLK7NP_005037.1 Tryp_SPc 29..245 CDD:214473 70/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.