DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:273 Identity:79/273 - (28%)
Similarity:123/273 - (45%) Gaps:29/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLARFLFYILVFSSLYCDLLA------LEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIIS 59
            |:|...|..:|:      ::||      ::..||||...|.....|.||:|:..|.|.|||.:|:
Zfish     1 MNLLLLLLCVLL------EILAVSCQDVIQARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLIN 59

  Fly    60 DRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYY--PDAIYLHCNYDSPKYQNDIGLLHLNES 122
            ..|::||.||..|....|:.....::...| |...:  |..:..|..||......||.|:.|...
Zfish    60 KYWVLTAAHCNIGEANMRIVAGDYSVGLYE-GMEQFRRPHMLIPHPQYDRSTNNADIMLIKLQSP 123

  Fly   123 ITFNALTQAVELPTSPFPRGASELV-FTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMS---- 182
            :..|:....|.||..........|. .:|||..::.|.:.|.|:.|:...:::..|....|    
Zfish   124 VYLNSYVSLVPLPRQDAMVAVGRLCSVSGWGFTTSTGGISSILRTVKLPIVSTAVCNGTDSFNGN 188

  Fly   183 AYEDLELGPCHICA-YRQANIGACHGDSGGPLVHQGTLVGILNFFVPCAQG-VPDIFMNIMYYRD 245
            ..|::      ||| |......||.||||||||.:|.:.||:::...||.. .|.::..:..:|.
Zfish   189 ITENM------ICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTAVSQFRQ 247

  Fly   246 WMRQTMSG-NGKC 257
            |:..|:.| .|:|
Zfish   248 WIDATIFGFYGRC 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 69/231 (30%)
Tryp_SPc 27..246 CDD:214473 68/227 (30%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 68/229 (30%)
Tryp_SPc 27..252 CDD:238113 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.