DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and LOC560023

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:272 Identity:81/272 - (29%)
Similarity:121/272 - (44%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LARFLFYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAG 67
            :|:.|:..||.:.:..|  |....|:|||........|||||| :...|.|||.:|..:|::||.
Zfish    22 MAQLLWVFLVLAVMVRD--AFSQRIIGGQEVVPYSIKYQVSLQ-VDRKHFCGGTLIQPQWVLTAA 83

  Fly    68 HCVKGYPTSRLQVATGTIRYA-EPG--AVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALT 129
            ||.:  |.|.:||.......| |.|  .|.....::.|..|:...:.|||.::.|......||..
Zfish    84 HCWR--PASVIQVVLSEHNLAVEEGFEQVCTVAKVFSHVAYNPKTFNNDIMIIKLTAPAQINAYV 146

  Fly   130 QAVELPTSPFPR--GASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLEL-GP 191
            |...|||:..|.  |.|....:|||           :.|:...:| ||...::     |:|: ..
Zfish   147 QPALLPTADTPELAGGSSCTVSGWG-----------VTRLYNFYL-SPILRAV-----DVEIFSS 194

  Fly   192 CHICAYRQANIG------------ACHGDSGGPLVHQGTLVGILNFFVPCA-QGVPDIFMNIMYY 243
            |.:..|.:.|..            :|.|||||||:..|.|.||:::.:.|| ...|.::..:..|
Zfish   195 CQLYYYYRVNDNMICAGSRFGGKDSCQGDSGGPLICDGYLEGIVSWGIGCALPYYPGVYTKVRNY 259

  Fly   244 R---DWMRQTMS 252
            .   ||:..|.|
Zfish   260 NRWIDWIISTES 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 73/244 (30%)
Tryp_SPc 27..246 CDD:214473 71/240 (30%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.