DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and KLK15

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:271 Identity:79/271 - (29%)
Similarity:122/271 - (45%) Gaps:38/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFYILVFSSLYCDLLALEHFIVGGQNAAEGD------APYQVSLQTLLGSHLCGGAIISDRWIIT 65
            ::.:|..|.|.....|.:     |....|||      .|:||:|.. .|...||.::||..|:::
Human     1 MWLLLTLSFLLASTAAQD-----GDKLLEGDECAPHSQPWQVALYE-RGRFNCGASLISPHWVLS 59

  Fly    66 AGHCVKGYPTSRLQVATGTIRYAE-PGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALT 129
            |.||...:  .|:::....:|..: |..:.....:..|..|::..::|||.||.|.:....|...
Human    60 AAHCQSRF--MRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQV 122

  Fly   130 QAVELPT-SPFPRGASELVFTGWGSQS-----AAGSLPSQLQRVQQQH------LNSPACESMMS 182
            :...||| .|.|..|  .|.:|||..|     .|||..||:......|      ::..:|:....
Human   123 RPAVLPTRCPHPGEA--CVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYP 185

  Fly   183 AYEDLELGPCHICAYRQANIGA--CHGDSGGPLVHQGTLVGILNF-FVPCAQGV-PDIFMNIMYY 243
            .    .|....:||..:.. ||  |.||||||||..|.|.||::: .|||.... |.::..:.:|
Human   186 G----RLTNTMVCAGAEGR-GAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHY 245

  Fly   244 RDWMRQTMSGN 254
            .:|:|:||..|
Human   246 LEWIRETMKRN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 72/245 (29%)
Tryp_SPc 27..246 CDD:214473 70/241 (29%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 68/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.