DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Elane

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:233 Identity:74/233 - (31%)
Similarity:102/233 - (43%) Gaps:21/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGT-- 84
            ||...||||:.|.....|:..|||. .|.|.||..:|:..::::|.|||.|.....:||..|.  
Mouse    24 ALASEIVGGRPARPHAWPFMASLQR-RGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHD 87

  Fly    85 IRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASE---L 146
            :|..|.....:.........:|..:..|||.::.||.|.|.||..|..:||..  .:|..:   .
Mouse    88 LRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQ--GQGVGDRTPC 150

  Fly   147 VFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGG 211
            :..|||........||.|     |.||.....:|...    .:..|.:...|||  |.|.|||||
Mouse   151 LAMGWGRLGTNRPSPSVL-----QELNVTVVTNMCRR----RVNVCTLVPRRQA--GICFGDSGG 204

  Fly   212 PLVHQGTLVGILNFF-VPCAQGV-PDIFMNIMYYRDWM 247
            |||....:.||.:|. ..|..|: ||.|..:..:.||:
Mouse   205 PLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 72/228 (32%)
Tryp_SPc 27..246 CDD:214473 70/225 (31%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 71/227 (31%)
Tryp_SPc 29..245 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.