DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and KLK14

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:238 Identity:81/238 - (34%)
Similarity:117/238 - (49%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EHFIVGGQNAAEGDAPYQVSLQTLLGSH---LCGGAIISDRWIITAGHCVKGYPTSRLQVATG-- 83
            |:.|:||........|:|.:|  |.|..   |||||::|.:|:|||.||  |.|.  ||||.|  
Human    22 ENKIIGGHTCTRSSQPWQAAL--LAGPRRRFLCGGALLSGQWVITAAHC--GRPI--LQVALGKH 80

  Fly    84 -TIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELV 147
             ..|:.....|........|.||:|..:.||:.||.|.:........:.:|:..:....|.|..|
Human    81 NLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRV 145

  Fly   148 FTGWGS-QSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICA-YRQANIGACHGDSG 210
             :|||: .|.....|:.||.|   ::|....|....|| ...:.|..:|| ..|....:|.||||
Human   146 -SGWGTISSPIARYPASLQCV---NINISPDEVCQKAY-PRTITPGMVCAGVPQGGKDSCQGDSG 205

  Fly   211 GPLVHQGTLVGILNFFVP-CA-QGVPDIFMNIMYYRDWMRQTM 251
            ||||.:|.|.|::::.:. || .|.|.::.|:..||.|:.:||
Human   206 GPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 78/232 (34%)
Tryp_SPc 27..246 CDD:214473 77/228 (34%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 78/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.