DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:240 Identity:80/240 - (33%)
Similarity:109/240 - (45%) Gaps:35/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLL---GSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATG-TIRY 87
            |..|..|.||..||.|.|  |.   |:..|||:||.:.|::||.||..|        |:| ||.|
  Fly    36 ITNGYPAYEGKVPYIVGL--LFSGNGNWWCGGSIIGNTWVLTAAHCTNG--------ASGVTINY 90

  Fly    88 -----AEPGAVYYPDA--IYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPT--SPFPRGA 143
                 .:|...::..:  |..|.:|:|....|||.|:. ...:.|.:|...||||:  ..:...|
  Fly    91 GASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIR-TPHVDFWSLVNKVELPSYNDRYQDYA 154

  Fly   144 S-ELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHG 207
            . ..|.:|||.......||..||.|..|.::...|....|.::::      ||.........|.|
  Fly   155 GWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTWSLHDNM------ICINTDGGKSTCGG 213

  Fly   208 DSGGPLV-HQGT-LVGILNF--FVPCAQGVPDIFMNIMYYRDWMR 248
            ||||||| |.|. |||:.:|  ...|..|.|.:|..:..|.||:|
  Fly   214 DSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 80/240 (33%)
Tryp_SPc 27..246 CDD:214473 77/236 (33%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.