DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG11841

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:267 Identity:69/267 - (25%)
Similarity:114/267 - (42%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSH---------LCGGAIISDRWIITAGHCVKGYPTSRLQVAT 82
            ||.|..|...:.|:...|     .|         .|||.:||:|.::||.||..........|..
  Fly    72 IVDGTPAEPKEFPFAARL-----GHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRL 131

  Fly    83 GTIRY------AEP---GAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSP 138
            |.:.:      |||   |.:    |:..|..:::|:..||||::.|:..:.||.......|   |
  Fly   132 GELEFDTDTDDAEPEDFGVL----ALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACL---P 189

  Fly   139 FPRGA--SELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELG---PCHICAYR 198
            |..|.  ...:..|||.:..|.....:|.:||.|.... .|.|.:.|.::|..|   ...:|...
  Fly   190 FDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKD-RCVSSVDANDELPNGYEPKSQLCIGS 253

  Fly   199 QANIGACHGDSGGPLV--HQGT-----LVGILNFFVPCA-QGVPDIFMNIMYYRDWMRQTMSGNG 255
            :.|...|:||||||::  |:..     ::||.:..:.|: ..:|..:..:.|:.:|::      |
  Fly   254 RDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIK------G 312

  Fly   256 KCAQVNQ 262
            :.|:..|
  Fly   313 ELAKQTQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 66/253 (26%)
Tryp_SPc 27..246 CDD:214473 65/249 (26%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 66/251 (26%)
Tryp_SPc 72..310 CDD:214473 65/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.