DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG10232

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:235 Identity:51/235 - (21%)
Similarity:92/235 - (39%) Gaps:35/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIY-------- 100
            |.|:..:  |.|::|:.|:::||.|||.........:....:|..|......||..:        
  Fly   281 LSTMTNN--CSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPF 343

  Fly   101 ---------LHCNY-DSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQS 155
                     :|..| ::.::::||.|:.|...:.:......:.:|..|.|.....|...|||  .
  Fly   344 VEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEILPICVPKDPIPLHNHPLQIAGWG--Y 406

  Fly   156 AAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLV------ 214
            ......||:......:.|...|:..:|.:.:    ...|||.......:|.|||||||:      
  Fly   407 TKNREYSQVLLHNTVYENRYYCQDKISFFRN----ESQICASGIRGEDSCEGDSGGPLMLTLNND 467

  Fly   215 HQGT--LVGILNF-FVPCAQGVPDIFMNIMYYRDWMRQTM 251
            :|..  |.||::: ...|....|.::.....:..|::..:
  Fly   468 YQDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIKANL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 51/232 (22%)
Tryp_SPc 27..246 CDD:214473 50/228 (22%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 51/232 (22%)
Tryp_SPc 260..503 CDD:214473 50/229 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.