DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG16710

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:296 Identity:66/296 - (22%)
Similarity:111/296 - (37%) Gaps:82/296 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSH------------LCGGAIISDRWIITAGHCV 70
            |..:...:.|.||:.....:.|:   :..:|.:|            .|.|::|::|:::||.||:
  Fly    97 CGPIMPAYRIFGGEETQPNELPW---MALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCL 158

  Fly    71 KGYPTSRLQVATG----TIRYAEPGAVYYPDAIYLHCN---YDSPKY------------------ 110
            :         .||    .:|..|...:..||.: .|.|   :.:|::                  
  Fly   159 R---------ITGLDLRRVRLGEHNILSNPDCV-THINGREHCAPEHLEIDVDLSIKHRHYMVFE 213

  Fly   111 ---QNDIGLLHLNESITFNALTQAVELPTSPFPRGAS----ELVFTGWGSQSAAGSLPSQLQRVQ 168
               .|||.||.|...:.:.|..:.:.:.........|    :|...|||.....| ..:.|.:..
  Fly   214 ERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQG-YSNVLLQAY 277

  Fly   169 QQHLNSPACESMMSAYEDLELG---PCHICAYRQANIG---ACHGDSGGPL---VHQGT-----L 219
            ....|:..|     :..:..||   ..||||   .|:|   .|.|||||||   :.:|.     |
  Fly   278 VNGRNADEC-----SLSEPSLGLDKETHICA---GNLGGNDTCKGDSGGPLMAIMERGDEEFVYL 334

  Fly   220 VGILNF-FVPCAQGVPDIFMNIMYYRDWMRQTMSGN 254
            .||.:: :..|..| |..:.....:.:|:...|..|
  Fly   335 AGITSYGYSQCGYG-PAAYTKTSKFVEWILWNMYTN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 63/281 (22%)
Tryp_SPc 27..246 CDD:214473 62/277 (22%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 62/279 (22%)
Tryp_SPc 106..362 CDD:238113 62/278 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.